PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_012590_kwxx.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23196.1 Da    PI: 8.2029
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_012590_kwxx.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.56.1e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien   rqvtf+kRr+g+lKKA+ELSvLCda+v v+ifs++gklye +
  Bv1_012590_kwxx.t1  9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDADVGVVIFSPQGKLYELA 58
                        79*********************************************965 PP

2K-box49.71.6e-179217616100
               K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                         +++ e++ +  ei+ L++ +  +lG + + +++ eL+ +e++Le+ + +iR++K+++++++i+ l++ke+ l+ +nk+L++k+ e
  Bv1_012590_kwxx.t1  92 ESKDEVNMMTHEIKLLEKGLWSILGGGEGAMTMDELHVMEKHLESWICQIRTTKMNIMFQEIQALKNKEDVLRAANKYLQQKIGE 176
                         6789******************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.913161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-29174IPR002100Transcription factor, MADS-box
CDDcd002652.51E-40276No hitNo description
PRINTSPR004041.8E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.6E-251056IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.590180IPR002487Transcription factor, K-box
PfamPF014865.0E-1793174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MARGKVQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD ADVGVVIFSP QGKLYELATK  60
GTMQGLIERY MKCTNGFHVA EPAAAIEKCM LESKDEVNMM THEIKLLEKG LWSILGGGEG  120
AMTMDELHVM EKHLESWICQ IRTTKMNIMF QEIQALKNKE DVLRAANKYL QQKIGEQEGF  180
YSFEQLTTNT PYALTIPSEI YQY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683233.11e-152PREDICTED: agamous-like MADS-box protein AGL12 isoform X1
SwissprotQ388411e-82AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A0J8CZV51e-152A0A0J8CZV5_BETVU; Uncharacterized protein
STRINGVIT_18s0041g02140.t018e-88(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.16e-84AGAMOUS-like 12